NEU1 Monoclonal antibody, PBS Only

• 

  WB analysis of PC-12 using 67032-1-Ig (same clone as 67032-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67032-1-Ig (NEU1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67032-1-Ig (same clone as 67032-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67032-1-Ig (NEU1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat pancreas using 67032-1-Ig (same clone as 67032-1-PBS)

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 67032-1-Ig (NEU1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 67032-1-Ig (same clone as 67032-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67032-1-Ig (NEU1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67032-1-Ig (same clone as 67032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67032-1-Ig (NEU1 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 67032-1-Ig (same clone as 67032-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using 67032-1-Ig (NEU1 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67032-1-PBS in a different storage buffer formulation.

NEU1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67032-1-PBS

Clone No.1F6D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1F6D1, Acetylneuraminyl hydrolase, EC:3.2.1.18, G9 sialidase, Lysosomal sialidase

---

Product Information

67032-1-PBS targets NEU1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27945

  Product name: Recombinant human NEU1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-415 aa of BC011900

  Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

• Full Name: sialidase 1 (lysosomal sialidase)
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC011900
• Gene Symbol: NEU1
• Gene ID (NCBI): 4758
• RRID: AB_2882347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99519
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal silic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflamation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Addition, it is reported that mutation in NEU1 of human could lead to sialidosis (PMID:14517945).