Tested Applications
| Positive WB detected in | PC-12 cells, pig liver tissue, rat liver tissue, rat pancreas tissue, mouse liver tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67032-1-Ig targets NEU1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27945 Product name: Recombinant human NEU1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 96-415 aa of BC011900 Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL Predict reactive species |
| Full Name | sialidase 1 (lysosomal sialidase) |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 45-48 kDa |
| GenBank Accession Number | BC011900 |
| Gene Symbol | NEU1 |
| Gene ID (NCBI) | 4758 |
| RRID | AB_2882347 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal sialic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflammation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Additionally, it is reported that mutations in human NEU1 could lead to sialidosis (PMID:14517945).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| IHC protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| WB protocol for NEU1 antibody 67032-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
67032-1-Ig is an anti-NEU1 (Neuraminidase 1) antibody with 16 citations. Publications appear in journals including Nature Communications, PLoS Biology, British Journal of Pharmacology, Biomedical Pharmacotherapy, Frontiers in Immunology, Life Sciences, Veterinary Research, and Virology. Research fields span renal fibrosis, sepsis and COVID-19, hepatocellular carcinoma, breast cancer, gastric cancer, esophageal carcinoma, atrial fibrillation, cardiorenal syndrome, intestinal barrier development, and infectious diseases (BCoV, Mycoplasma, Coxiella burnetii, swine influenza).
| Species | Application | Title |
|---|---|---|
Research (Wash D C) Proteogenomic Characterization of High-Grade Lung Neuroendocrine Carcinoma Deciphers Molecular Diversity and Potential Biomarkers of Different Histological Subtypes in Chinese Population | ||
Phytomedicine Salvia miltiorrhiza extract attenuates cardiorenal syndrome by inhibiting IL-1β mediated cross-talk between heart and kidney. | ||
Br J Pharmacol Neuraminidase is a host-directed approach to regulate neutrophil responses in sepsis and COVID-19 | ||
Biomed Pharmacother Oseltamivir enhances 5-FU sensitivity in esophageal squamous carcinoma with high SPNS1 | ||
Front Immunol Integration of single-cell sequencing, transcriptome sequencing, and machine learning for constructing and validating histone acetylation-related prognostic risk models in hepatocellular carcinoma.
|
Reviews
What customers say
All four reviews are 5-star ratings. Users report the antibody performs well across multiple applications, including immunofluorescence, Western blot, immunohistochemistry, and immunoprecipitation. It was tested on mESCs and Beas 2B cells, with a 1:2000 dilution noted for the latter. Overall feedback is positive, with comments describing the product as working as expected and performing well. All reviews reference the same lot (10020629), indicating consistent performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Stephanie (Verified Customer) (12-04-2025) | Works as expected
|
SONAL (Verified Customer) (10-29-2025) | good
|
SONAL (Verified Customer) (10-29-2025) | good
|
SONAL (Verified Customer) (10-29-2025) | good
|
