NFATC1 Polyclonal antibody

• 

  WB analysis using 30114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30114-1-AP (NFATC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-251 using 30114-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using NFATC1 antibody (30114-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NFATC1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30114-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IF/ICC, ELISA

Synonyms

NF ATC, NF ATc1, NFAT2, NFATc, NFATC1

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

30114-1-AP targets NFATC1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32365

  Product name: Recombinant human NFATC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 197-304 aa of BC104753

  Sequence: YASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNT

• Full Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
• Calculated Molecular Weight: 716aa,78 kDa; 943aa,101 kDa
• Observed Molecular Weight: 82-140 kDa
• GenBank Accession Number: BC104753
• Gene Symbol: NFATC1
• Gene ID (NCBI): 4772
• RRID: AB_3086233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95644
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor of activated T-cells cytoplasmic (NFATC) is a family of transcription factors originally identified in T-cells. The family has five members (NFATC1 through NFATC5), which play roles both within and outside the immune system. NFATC1 is widely expressed and resides in endocardial cushion endothelial cells, skeletal muscle fibers, T lymphocytes, osteoblasts, osteoclasts, etc. The autoregulation of NFATC1 is a crucial step for cell fate determination. It is a master regulator of RANKL-induced osteoclast differentiation and plays a pivotal role in osteoclast fusion and osteoclast activation via up-regulation of various genes responsible for osteoclast adhesion, migration, acidification, degradation of inorganic and organic bone matrix (PMID: 20035895, PMID: 19754901). NFAT proteins is alternatively modified to generate splice variants. NFATC1 can be detected isoforms of 82-140 kDa (PMID: 18097033).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat, mouse	WB	Toxicol Appl Pharmacol; Exploring the role of metformin in high fluoride ingestion-induced bone lesions.; Authors - Wenshu Xu
mouse	WB	Phytomedicine; A novel METTL3 inhibitor nimbolide ameliorates osteoporosis via orchestrating osteoclastogenesis in an m6A-dependent manner.; Authors - Chenhui Cai