Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30114-1-AP targets NFATC1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32365 Product name: Recombinant human NFATC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 197-304 aa of BC104753 Sequence: YASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNT Predict reactive species |
| Full Name | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 |
| Calculated Molecular Weight | 716aa,78 kDa; 943aa,101 kDa |
| Observed Molecular Weight | 82-140 kDa |
| GenBank Accession Number | BC104753 |
| Gene Symbol | NFATC1 |
| Gene ID (NCBI) | 4772 |
| RRID | AB_3086233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95644 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor of activated T-cells cytoplasmic (NFATC) is a family of transcription factors originally identified in T-cells. The family has five members (NFATC1 through NFATC5), which play roles both within and outside the immune system. NFATC1 is widely expressed and resides in endocardial cushion endothelial cells, skeletal muscle fibers, T lymphocytes, osteoblasts, osteoclasts, etc. The autoregulation of NFATC1 is a crucial step for cell fate determination. It is a master regulator of RANKL-induced osteoclast differentiation and plays a pivotal role in osteoclast fusion and osteoclast activation via up-regulation of various genes responsible for osteoclast adhesion, migration, acidification, degradation of inorganic and organic bone matrix (PMID: 20035895, PMID: 19754901). NFAT proteins is alternatively modified to generate splice variants. NFATC1 can be detected isoforms of 82-140 kDa (PMID: 18097033).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NFATC1 antibody 30114-1-AP | Download protocol |
| WB protocol for NFATC1 antibody 30114-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



