Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, Jurkat cells, Raji cells, U-87 MG cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14220-1-AP targets NFKB1 p105/p50 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, monkey, chicken, bovine, ducks |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5458 Product name: Recombinant human NFKB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-370 aa of BC051765 Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN Predict reactive species |
| Full Name | nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 50 kDa, 105 kDa |
| GenBank Accession Number | BC051765 |
| Gene Symbol | NFKB1 |
| Gene ID (NCBI) | 4790 |
| RRID | AB_2153393 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19838 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NFkB is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NFkB is activated by various intra- and extracellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo- and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. This antibody can bind both p105 and p50 isoforms of NFKB1.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NFKB1 p105/p50 antibody 14220-1-AP | Download protocol |
| IF protocol for NFKB1 p105/p50 antibody 14220-1-AP | Download protocol |
| IHC protocol for NFKB1 p105/p50 antibody 14220-1-AP | Download protocol |
| IP protocol for NFKB1 p105/p50 antibody 14220-1-AP | Download protocol |
| WB protocol for NFKB1 p105/p50 antibody 14220-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Immunol NKILA lncRNA promotes tumor immune evasion by sensitizing T cells to activation-induced cell death. | ||
Nucleic Acids Res p38-mediated FOXN3 phosphorylation modulates lung inflammation and injury through the NF-κB signaling pathway | ||
Nat Microbiol Chloroquine ameliorates carbon tetrachloride-induced acute liver injury in mice via the concomitant inhibition of inflammation and induction of apoptosis | ||
Adv Sci (Weinh) CXCL13 Expression Promotes CAR T Cell Antitumor Activity and Potentiates Response to PD-1 Blockade | ||
Sci Adv Microglial Ffar4 deficiency promotes cognitive impairment in the context of metabolic syndrome | ||
Biomaterials A multifunctional anti-inflammatory drug that can specifically target activated macrophages, massively deplete intracellular H2O2, and produce large amounts CO for a highly efficient treatment of osteoarthritis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Vikas (Verified Customer) (04-23-2024) | Used NF-KB antibody for western 1:1000 dilution, worked very well, highly recommended product.
|
FH Ane (Verified Customer) (09-18-2023) | This antibody was used to detect p50 at different cell compartments and worked fine to dectect both phosphorilated and unphosphorilated forms of p50 in all cell compartments
![]() |












