Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, THP-1 cells |
| Positive IHC detected in | human stomach cancer tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IF | See 4 publications below |
| ChIP | See 1 publications below |
Product Information
66992-1-Ig targets NFKB1 p105/p50 in WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5832 Product name: Recombinant human NFKB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-370 aa of BC051765 Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN Predict reactive species |
| Full Name | nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 50 kDa, 105 kDa |
| GenBank Accession Number | BC051765 |
| Gene Symbol | NFKB1 |
| Gene ID (NCBI) | 4790 |
| RRID | AB_2882309 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P19838 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NFkB is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NFkB is activated by various intra- and extracellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo- and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. This antibody can bind both p105 and p50 isoforms of NFKB1.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NFKB1 p105/p50 antibody 66992-1-Ig | Download protocol |
| IF protocol for NFKB1 p105/p50 antibody 66992-1-Ig | Download protocol |
| IHC protocol for NFKB1 p105/p50 antibody 66992-1-Ig | Download protocol |
| WB protocol for NFKB1 p105/p50 antibody 66992-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Commun Biol EZH2 elicits CD8+ T-cell desert in esophageal squamous cell carcinoma via suppressing CXCL9 and dendritic cells | ||
J Ethnopharmacol Sub-chronic exposure to realgar induces liver injury via upregulating the TXNIP/NLRP3 pathway and disturbing bile acid homeostasis in mice | ||
Chem Biol Drug Des Caffeic acid-grafted chitooligosaccharides downregulate MAPK and NF-kB in RAW264.7 cells | ||
Cell Commun Signal Semaphorin 7A interacts with nuclear factor NF-kappa-B p105 via integrin β1 and mediates inflammation | ||
Cell Death Dis Epoxy metabolites of linoleic acid promote the development of breast cancer via orchestrating PLEC/NFκB1/CXCL9-mediated tumor growth and metastasis | ||
Circ Res Spatiotemporal ATF3 Expression Determines VSMC Fate in Abdominal Aortic Aneurysm |

























