NFKB1 p105/p50 Polyclonal antibody, PBS Only

NFKB1 p105/p50 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 14220-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

NFKB1, DNA binding factor KBF1, DNA-binding factor KBF1, EBP 1, EBP-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14220-1-PBS targets NFKB1 p105/p50 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5458

Product name: Recombinant human NFKB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-370 aa of BC051765

Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN

Predict reactive species
Full Name nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Calculated Molecular Weight 105 kDa
Observed Molecular Weight 50 kDa, 105 kDa
GenBank Accession NumberBC051765
Gene Symbol NFKB1
Gene ID (NCBI) 4790
RRIDAB_2153393
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19838
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NFkB is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NFkB is activated by various intra- and extracellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo- and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. This antibody can bind both p105 and p50 isoforms of NFKB1.

Loading...
||
New chat

Able

正在加载,请稍候...