NFKB1,p105,p50 Polyclonal antibody

NFKB1,p105,p50 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA
Cat No. 14220-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (8)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

NFKB1, NF kappa B, KBF1, EBP-1, EBP 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells, Jurkat cells, Raji cells, U-87 MG cells
Positive IP detected inJurkat cells
Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14220-1-AP targets NFKB1,p105,p50 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, monkey, chicken, bovine, ducks
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5458

Product name: Recombinant human NFKB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-370 aa of BC051765

Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN

Predict reactive species
Full Name nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Calculated Molecular Weight 105 kDa
Observed Molecular Weight 50 kDa, 105 kDa
GenBank Accession NumberBC051765
Gene Symbol NFKB1
Gene ID (NCBI) 4790
RRIDAB_2153393
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19838
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFkB is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NFkB is activated by various intra- and extracellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo- and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. This antibody can bind both p105 and p50 isoforms of NFKB1.

Protocols

Product Specific Protocols
WB protocol for NFKB1,p105,p50 antibody 14220-1-APDownload protocol
IF protocol for NFKB1,p105,p50 antibody 14220-1-APDownload protocol
IP protocol for NFKB1,p105,p50 antibody 14220-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

Nat Immunol

NKILA lncRNA promotes tumor immune evasion by sensitizing T cells to activation-induced cell death.

Authors - Di Huang
humanIF

Nucleic Acids Res

p38-mediated FOXN3 phosphorylation modulates lung inflammation and injury through the NF-κB signaling pathway

Authors - Xinxing Zhu
mouseWB

Nat Microbiol

Chloroquine ameliorates carbon tetrachloride-induced acute liver injury in mice via the concomitant inhibition of inflammation and induction of apoptosis

Authors - Tomas Doyle
mouse

Sci Adv

Microglial Ffar4 deficiency promotes cognitive impairment in the context of metabolic syndrome

Authors - Wei Wang
mouseWB

Biomaterials

A multifunctional anti-inflammatory drug that can specifically target activated macrophages, massively deplete intracellular H2O2, and produce large amounts CO for a highly efficient treatment of osteoarthritis.

Authors - Guangzhen Yang
humanWB

EMBO J

The p53-inducible long noncoding RNA TRINGS protects cancer cells from necrosis under glucose starvation.

Authors - Muhammad Riaz Khan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vikas (Verified Customer) (04-23-2024)

Used NF-KB antibody for western 1:1000 dilution, worked very well, highly recommended product.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SH-SY5Y cell line
FH

Ane (Verified Customer) (09-18-2023)

This antibody was used to detect p50 at different cell compartments and worked fine to dectect both phosphorilated and unphosphorilated forms of p50 in all cell compartments

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCT-15 cell line
NFKB1,p105,p50 Antibody Western Blot validation (1:1000 dilution) in HCT-15 cell line (Cat no:14220-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...