Product Information
20474-1-AP targets NHE1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14324 Product name: Recombinant human NHE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species |
| Full Name | solute carrier family 9 (sodium/hydrogen exchanger), member 1 |
| Calculated Molecular Weight | 815 aa, 91 kDa |
| GenBank Accession Number | BC012121 |
| Gene Symbol | NHE1 |
| Gene ID (NCBI) | 6548 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19634 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The NHE1 Polyclonal antibody (Cat# 20474-1-AP) has 1 total citation. The cited publication appeared in International Journal of Oncology (IF 7.3, 2015), investigating how HPV16 E7 elevates miR-27b to inhibit PPARγ expression and promote proliferation and invasion in cervical carcinoma cells. The antibody was used for Western blot. The research field encompasses oncology, specifically cervical carcinoma biology, viral oncogenesis (HPV), microRNA regulation, and nuclear receptor signaling.
| Species | Application | Title |
|---|---|---|
Int J Oncol Elevation of miR-27b by HPV16 E7 inhibits PPARγ expression and promotes proliferation and invasion in cervical carcinoma cells. |
