Published Applications
| WB | See 1 publications below |
Product Information
20474-1-AP targets NHE1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14324 Product name: Recombinant human NHE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species |
| Full Name | solute carrier family 9 (sodium/hydrogen exchanger), member 1 |
| Calculated Molecular Weight | 815 aa, 91 kDa |
| GenBank Accession Number | BC012121 |
| Gene Symbol | NHE1 |
| Gene ID (NCBI) | 6548 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19634 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
