Tested Applications
Positive WB detected in | A549 cells, NCI-H1299 cells, HEK-293 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, PC-12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 6 publications below |
IHC | See 2 publications below |
Product Information
67363-1-Ig targets NHE1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14329 Product name: Recombinant human NHE1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species |
Full Name | solute carrier family 9 (sodium/hydrogen exchanger), member 1 |
Calculated Molecular Weight | 815 aa, 91 kDa |
Observed Molecular Weight | 110 kDa |
GenBank Accession Number | BC012121 |
Gene Symbol | NHE1 |
Gene ID (NCBI) | 6548 |
RRID | AB_2882615 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P19634 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NHE1, also named as SLC9A1, is involved in pH regulation that can eliminate acids generated by active metabolism and counter adverse environmental conditions. NHE1 plays an important role in signal transduction. It has been shown that NHE1 participates in the development and progression of human breast cancer, gastric cancer and others. NHE1 has some isoforms with 91 kDa , 110 kDa (phosphoglycoprotein) and 210 kDa (dimeric protein). (PMID:28098891, 27751915, 8300588)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NHE1 antibody 67363-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Pharmacol Sin Direct cardio-protection of Dapagliflozin against obesity-related cardiomyopathy via NHE1/MAPK signaling.
| ||
Reproduction An abnormal LPA/LPAR1-NHE1 axis leads to the autophagy deficiency of trophoblast cells in recurrent spontaneous abortion | ||
Cell Rep Carbonic anhydrase 2 facilitates sorafenib resistance by counteracting MCT4-mediated intracellular pH dysregulation in HCC | ||
Cell Rep Mitochondrial transplantation rescues Ca2+ homeostasis imbalance and myocardial hypertrophy in SLC25A3-related hypertrophic cardiomyopathy | ||
bioRxiv Cystinosin is involved in Na+/H+ Exchanger 3 trafficking in the proximal tubular cells: new insights in the renal Fanconi syndrome in cystinosis | ||
Adv Sci (Weinh) A Human Engineered Heart Tissue-Derived Lipotoxic Diabetic Cardiomyopathy Model Revealed Early Benefits of Empagliflozin |