NHEDC2 Polyclonal antibody, PBS Only

• 

  WB analysis of human plasma using 24065-1-AP (same clone as 24065-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 24065-1-AP (NHEDC2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 24065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24065-1-AP (same clone as 24065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24065-1-AP (NHEDC2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24065-1-AP (same clone as 24065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24065-1-AP (NHEDC2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24065-1-PBS in a different storage buffer formulation.

NHEDC2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24065-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24065-1-PBS targets NHEDC2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21141

  Product name: Recombinant human NHEDC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-156 aa of BC047447

  Sequence: MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLI

• Full Name: Na+/H+ exchanger domain containing 2
• Calculated Molecular Weight: 537 aa, 58 kDa
• Observed Molecular Weight: ~55 kDa
• GenBank Accession Number: BC047447
• Gene Symbol: NHEDC2
• Gene ID (NCBI): 133308
• RRID: AB_2879423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q86UD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NHEDC2, also named as NHA2 and SLC9B2, contributes to the organellar volume homeostasis. It is required for osteoclast differentiation and bone resorption activity. NHEDC2 has two isoforms with MW 48 kDa and 58 kDa.