NIFK Polyclonal antibody, PBS Only

• 

  WB analysis using 12615-1-AP (same clone as 12615-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12615-1-AP (NIFK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12615-1-AP (same clone as 12615-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12615-1-AP (MKI67IP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12615-1-AP (same clone as 12615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12615-1-AP (same clone as 12615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 12615-1-AP (same clone as 12615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 12615-1-AP (same clone as 12615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12615-1-AP (NIFK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 12615-1-AP (same clone as 12615-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 12615-1-AP (NIFK antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 12615-1-AP (same clone as 12615-1-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug NIFK Polyclonal antibody (12615-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 12615-1-PBS in a different storage buffer formulation.

NIFK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 12615-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

---

Product Information

12615-1-PBS targets NIFK in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3284

  Product name: Recombinant human MKI67IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5-293 aa of BC024238

  Sequence: SGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

• Full Name: MKI67 (FHA domain) interacting nucleolar phosphoprotein
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC024238
• Gene Symbol: NIFK
• Gene ID (NCBI): 84365
• RRID: AB_2142384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYG3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.