Product Information
25497-1-AP targets NIPAL1 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22025 Product name: Recombinant human NIPAL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 359-411 aa of BC067881 Sequence: NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD Predict reactive species |
| Full Name | NIPA-like domain containing 1 |
| Calculated Molecular Weight | 410 aa, 45 kDa |
| GenBank Accession Number | BC067881 |
| Gene Symbol | NIPAL1 |
| Gene ID (NCBI) | 152519 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6NVV3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
