SLC12A1/NKCC2 Polyclonal antibody, PBS Only

• 

  WB analysis using 13636-1-AP (same clone as 13636-1-PBS)

  Untreated and 37°C incubated mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13636-1-AP (SLC12A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13636-1-PBS in a different storage buffer formulation.

SLC12A1/NKCC2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13636-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

NKCC2, SLC12A1, BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter

---

Product Information

13636-1-PBS targets SLC12A1/NKCC2 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4564

  Product name: Recombinant human SLC12A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC040138

  Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK

• Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 140-180 kDa
• GenBank Accession Number: BC040138
• Gene Symbol: SLC12A1/NKCC2
• Gene ID (NCBI): 6557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13621
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.