SLC12A1/NKCC2 Polyclonal antibody

• 

  WB analysis using 13636-1-AP

  Untreated and 37°C incubated mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13636-1-AP (SLC12A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

SLC12A1/NKCC2 Polyclonal Antibody for WB, ELISA

Cat No. 13636-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

NKCC2, SLC12A1, BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter

---

Tested Applications

• Positive WB detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13636-1-AP targets SLC12A1/NKCC2 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4564

  Product name: Recombinant human SLC12A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC040138

  Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK

• Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 140-180 kDa
• GenBank Accession Number: BC040138
• Gene Symbol: SLC12A1/NKCC2
• Gene ID (NCBI): 6557
• RRID: AB_3085420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13621
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.