NKX2-5 Polyclonal antibody, PBS Only

• 

  WB analysis of human heart using 13921-1-AP (same clone as 13921-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 13921-1-AP (NKX2-5 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 13921-1-AP (same clone as 13921-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 13921-1-AP (NKX2-5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13921-1-AP (same clone as 13921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 13921-1-AP (NKX2-5 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 13921-1-AP (same clone as 13921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13921-1-AP (NKX2-5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 13921-1-AP (same clone as 13921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13921-1-AP (NKX2-5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13921-1-AP (same clone as 13921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 13921-1-AP (NKX2-5 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse embryo using 13921-1-AP (same clone as 13921-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse embryo tissue using NKX2-5 antibody (13921-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13921-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NKX2-5 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 13921-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

13921-1-PBS targets NKX2-5 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4930

  Product name: Recombinant human NKX2-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC025711

  Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW

• Full Name: NK2 transcription factor related, locus 5 (Drosophila)
• Calculated Molecular Weight: 324 aa, 35 kDa
• Observed Molecular Weight: 30-42 kda
• GenBank Accession Number: BC025711
• Gene Symbol: NKX2-5
• Gene ID (NCBI): 1482
• RRID: AB_1851479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52952
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development [PMID: 7665173]. NKX2-5 encoded by homeobox-containing genes that implicated in commitment to and/or differentiation of the myocardial lineage, and acts as a transcriptional activator of ANF in cooperation with GATA4. During embryonic development, NKX2-5 plays pivotal roles in specifying cardiac progenitors, cardiac morphogenesis, cardiomyocyte differentiation and conduction system development [PMID: 22824467].