Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NKX2-5 Polyclonal antibody

NKX2-5 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 13921-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

NKX25, Cardiac-specific homeobox, CHNG5, CSX, Homeobox protein NK-2 homolog E

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue
Positive IHC detected inhuman brain tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse embryo tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13921-1-AP targets NKX2-5 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4930

Product name: Recombinant human NKX2-5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-324 aa of BC025711

Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW

Predict reactive species
Full Name NK2 transcription factor related, locus 5 (Drosophila)
Calculated Molecular Weight 324 aa, 35 kDa
Observed Molecular Weight30-42 kda
GenBank Accession NumberBC025711
Gene Symbol NKX2-5
Gene ID (NCBI) 1482
RRIDAB_1851479
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP52952
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development [PMID: 7665173]. NKX2-5 encoded by homeobox-containing genes that implicated in commitment to and/or differentiation of the myocardial lineage, and acts as a transcriptional activator of ANF in cooperation with GATA4. During embryonic development, NKX2-5 plays pivotal roles in specifying cardiac progenitors, cardiac morphogenesis, cardiomyocyte differentiation and conduction system development [PMID: 22824467].

Protocols

Product Specific Protocols
FC protocol for NKX2-5 antibody 13921-1-APDownload protocol
IF protocol for NKX2-5 antibody 13921-1-APDownload protocol
IHC protocol for NKX2-5 antibody 13921-1-APDownload protocol
WB protocol for NKX2-5 antibody 13921-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Rep

Post-transcriptional Regulation of Nkx2-5 by RHAU in Heart Development.

Authors - Junwei Nie
humanIF

iScience

A dual SHOX2:GFP; MYH6:mCherry knockin hESC reporter line for derivation of human SAN-like cells.

Authors - Zaniar Ghazizadeh
ratWB

Am J Physiol Heart Circ Physiol

Homocysteine downregulates cardiac homeobox transcription factor NKX2.5 via IGFBP5.

Authors - Guangrui Lai
mouseWB

J Appl Toxicol

The effect of maternal exposure to di-(2-ethylhexyl)-phthalate on fetal cardiac development in mice.

Authors - Changqing Tang
ratWB

Mol Med Rep

H3K9me2 regulates early transcription factors to promote mesenchymal stem‑cell differentiation into cardiomyocytes.

Authors - Xiaolin Sun
ratIF

Int J Clin Exp Pathol

SDF-1α promotes repair of myocardial ischemic necrosis zones in rats.

Authors - Xinhua Cai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Rebecca (Verified Customer) (10-25-2022)

20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: iPSC-CM
NKX2-5 Antibody Western Blot validation (1:1000 dilution) in iPSC-CM (Cat no:13921-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...