Tested Applications
| Positive WB detected in | human heart tissue |
| Positive IHC detected in | human brain tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse embryo tissue |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13921-1-AP targets NKX2-5 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4930 Product name: Recombinant human NKX2-5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC025711 Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW Predict reactive species |
| Full Name | NK2 transcription factor related, locus 5 (Drosophila) |
| Calculated Molecular Weight | 324 aa, 35 kDa |
| Observed Molecular Weight | 30-42 kda |
| GenBank Accession Number | BC025711 |
| Gene Symbol | NKX2-5 |
| Gene ID (NCBI) | 1482 |
| RRID | AB_1851479 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52952 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development [PMID: 7665173]. NKX2-5 encoded by homeobox-containing genes that implicated in commitment to and/or differentiation of the myocardial lineage, and acts as a transcriptional activator of ANF in cooperation with GATA4. During embryonic development, NKX2-5 plays pivotal roles in specifying cardiac progenitors, cardiac morphogenesis, cardiomyocyte differentiation and conduction system development [PMID: 22824467].
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NKX2-5 antibody 13921-1-AP | Download protocol |
| IF protocol for NKX2-5 antibody 13921-1-AP | Download protocol |
| IHC protocol for NKX2-5 antibody 13921-1-AP | Download protocol |
| WB protocol for NKX2-5 antibody 13921-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-NKX2-5 antibody (Cat# 13921-1-AP) has 14 citations. These appear in journals including Cell Reports, Cell Reports Medicine, Oxidative Medicine and Cellular Longevity, European Journal of Pharmacology, Molecular Medicine Reports, Stem Cells, iScience, Cell Stress & Chaperones, American Journal of Physiology, Journal of Applied Toxicology, PLoS One, Medical Science Monitor, International Journal of Clinical and Experimental Pathology, and Aging. Research fields center on cardiac development, cardiomyocyte differentiation, congenital heart defects, and sinoatrial node function, with one study on nasopharyngeal carcinoma metastasis.
| Species | Application | Title |
|---|---|---|
Cell Rep Med DDX5 super-enhancer promotes vasculogenic mimicry formation and metastasis in nasopharyngeal carcinoma by enhancing ADAM10 transcription | ||
Oxid Med Cell Longev NRF-2/HO-1 Pathway-Mediated SHOX2 Activation Is a Key Switch for Heart Rate Acceleration by Yixin-Fumai Granules | ||
Eur J Pharmacol Super-enhancer-driven lncRNA Snhg7 aggravates cardiac hypertrophy via Tbx5/GLS2/ferroptosis axis | ||
Mol Med Rep H3K9me2 regulates early transcription factors to promote mesenchymal stem‑cell differentiation into cardiomyocytes. | ||
Stem Cells LncCMRR plays an important role in cardiac differentiation by regulating the Purb/Flk1 axis |
Reviews
What customers say
The single review for this product is a 5-star rating for Western Blot. The user tested it on iPSC-CM cells using a 1:1000 dilution, loading 20 µg of protein. Transference was performed at 4 °C and 90 V for 2 hours, with antibody incubation overnight at 4 °C. The reviewer was satisfied with the result, indicating the antibody performed well under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rebecca (Verified Customer) (10-25-2022) | 20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC.
 |
