NKp46/NCR1/CD335 Recombinant monoclonal antibody, PBS Only

• 

NKp46/NCR1/CD335 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85021-3-PBS

Clone No.242549H4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CD335, hNKp46, LY94, Natural killer cell p46-related protein, NCR 1

---

Product Information

85021-3-PBS targets NKp46/NCR1/CD335 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1364

  Product name: Recombinant Human NKp46/NCR1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-258 aa of /

  Sequence: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR

• Full Name: natural cytotoxicity triggering receptor 1
• Calculated Molecular Weight: 34kDa
• GenBank Accession Number: /
• Gene Symbol: NCR1
• Gene ID (NCBI): 9437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76036-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.