NLE1 Polyclonal antibody, PBS Only

• 

  WB analysis of BxPC-3 using 16419-1-AP (same clone as 16419-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 16419-1-AP (NLE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16419-1-PBS in a different storage buffer formulation.

NLE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16419-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16419-1-PBS targets NLE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9604

  Product name: Recombinant human NLE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-485 aa of BC012075

  Sequence: TVRFWDLSTETPHFTCKGHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWRR

• Full Name: notchless homolog 1 (Drosophila)
• Calculated Molecular Weight: 485 aa, 53 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC012075
• Gene Symbol: NLE1
• Gene ID (NCBI): 54475
• RRID: AB_2878256
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVX2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.