Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29319-1-AP targets NLGN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30536 Product name: Recombinant human NLGN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 38-142 aa of BC051715 Sequence: QAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPYWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCL Predict reactive species |
| Full Name | neuroligin 3 |
| Calculated Molecular Weight | 94 kDa |
| Observed Molecular Weight | 90-110 kDa |
| GenBank Accession Number | BC051715 |
| Gene Symbol | NLGN3 |
| Gene ID (NCBI) | 54413 |
| RRID | AB_3086116 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZ94 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuroligin3 (NLGN3) belongs to the neuroligin family, a class of postsynaptic cell adhesion molecules that regulate synapse organization and dendritic outgrowth, and NLGN3 missense variants have previously been associated with autistic spectrum disorder (ASD).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NLGN3 antibody 29319-1-AP | Download protocol |
| WB protocol for NLGN3 antibody 29319-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wojciech (Verified Customer) (07-23-2025) | Used for WB and 1:1000 dilution. Detected a clear band at around 75 kDa.
|
FH Wojciech (Verified Customer) (07-10-2025) | The antibody was used for Western blotting in cell lysates. A prominent band was observed at the ~75 kDa. While some non-specific bands were present ~60 kDa.
|





