NLGN3 Polyclonal antibody, PBS Only

• 

  WB analysis using 29319-1-AP (same clone as 29319-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29319-1-AP (NLGN3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29319-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29319-1-AP (same clone as 29319-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29319-1-AP (NLGN3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29319-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29319-1-AP (same clone as 29319-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29319-1-AP (NLGN3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29319-1-PBS in a different storage buffer formulation.

NLGN3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29319-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

NL3, Neuroligin-3, neuroligin 3, HNL3, AUTSX1

---

Product Information

29319-1-PBS targets NLGN3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30536

  Product name: Recombinant human NLGN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-142 aa of BC051715

  Sequence: QAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPYWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCL

• Full Name: neuroligin 3
• Calculated Molecular Weight: 94 kDa
• Observed Molecular Weight: 90-110 kDa
• GenBank Accession Number: BC051715
• Gene Symbol: NLGN3
• Gene ID (NCBI): 54413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ94
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuroligin3 (NLGN3) belongs to the neuroligin family, a class of postsynaptic cell adhesion molecules that regulate synapse organization and dendritic outgrowth, and NLGN3 missense variants have previously been associated with autistic spectrum disorder (ASD).