Tested Applications
Positive WB detected in | A549 cells, HeLa cells, PC-3 cells, U-251 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13489-1-AP targets NLGN4Y in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4311 Product name: Recombinant human NLGN4Y protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC032567 Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEAR Predict reactive species |
Full Name | neuroligin 4, Y-linked |
Calculated Molecular Weight | 816 aa, 92 kDa |
Observed Molecular Weight | 92 kDa |
GenBank Accession Number | BC032567 |
Gene Symbol | NLGN4Y |
Gene ID (NCBI) | 22829 |
RRID | AB_2235981 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NFZ3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NLGN4Y, one member of Neuroligins, is cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses , NLGN4Y was expressed in fetal and adult brain, prostate, testis, pancreas. NLGN4Y is homologous with its X-linked homolog, NLGN4X. The antibody can recognize both of NLGN4Y and NLGN4X at 72kDa mature form.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NLGN4Y antibody 13489-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |