NMES1 Polyclonal antibody

• 

  WB analysis using 25102-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25102-1-AP (NMES1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

NMES1 Polyclonal Antibody for WB, ELISA

Cat No. 25102-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C15orf48, FOAP 11, NMES1, Protein FOAP 11

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse colon tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25102-1-AP targets NMES1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18744

  Product name: Recombinant human C15orf48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3-83 aa of BC021173

  Sequence: FFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK

• Full Name: chromosome 15 open reading frame 48
• Calculated Molecular Weight: 83 aa, 9 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC021173
• Gene Symbol: C15orf48
• Gene ID (NCBI): 84419
• RRID: AB_3669463
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C002
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nmes1, encoding for Normal Mucosa of Esophagus-Specific gene 1, also known as C15orf48, Modulator of Cytochrome C Oxidase during Inflammation [MOCCI]), was first identified in a study of human esophageal squamous cell carcinoma (ESCC) tissues (PMID: 30013631). Nmes1 is expressed in epithelial tissue and is believed to be a tumor suppressor gene. Nmes1 encodes for a small protein consisting of 83 amino acid and is a nuclear protein (PMID: 37971166).