Tested Applications
Positive WB detected in | fetal human brain tissue, SH-SY5Y cells |
Positive IHC detected in | human pituitary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
26905-1-AP targets Neuronatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25408 Product name: Recombinant human NNAT protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 40-81 aa of BC001768 Sequence: NPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN Predict reactive species |
Full Name | neuronatin |
Calculated Molecular Weight | 9 kDa |
Observed Molecular Weight | 9 kDa |
GenBank Accession Number | BC001768 |
Gene Symbol | NNAT |
Gene ID (NCBI) | 4826 |
RRID | AB_2880678 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16517 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Neuronatin antibody 26905-1-AP | Download protocol |
IHC protocol for Neuronatin antibody 26905-1-AP | Download protocol |
IF protocol for Neuronatin antibody 26905-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci Characterizing SERCA Function in Murine Skeletal Muscles after 35-37 Days of Spaceflight. | ||
Front Cardiovasc Med MiR-3064 in Epicardial Adipose-Derived Exosomes Targets Neuronatin to Regulate Adipogenic Differentiation of Epicardial Adipose Stem Cells. | ||
FEBS Lett Neuronatin promotes SERCA uncoupling and its expression is altered in skeletal muscles of high-fat diet-fed mice. | ||
J Toxicol Sci Lidocaine prevents breast cancer growth by targeting neuronatin to inhibit nerve fibers formation. | ||
J Biol Chem Low dose lithium supplementation promotes adipose tissue browning and sarco(endo)plasmic reticulum Ca2+ ATPase uncoupling in muscle |