Neuronatin Polyclonal antibody

• 

  WB analysis of fetal human brain using 26905-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 26905-1-AP (Neuronatin antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 26905-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 26905-1-AP (Neuronatin antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pituitary using 26905-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 26905-1-AP (Neuronatin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary using 26905-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 26905-1-AP (Neuronatin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 26905-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using 26905-1-AP (Neuronatin antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

Neuronatin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26905-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

neuronatin, NNAT, Peg5

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, SH-SY5Y cells
• Positive IHC detected in: human pituitary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26905-1-AP targets Neuronatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25408

  Product name: Recombinant human NNAT protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 40-81 aa of BC001768

  Sequence: NPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

• Full Name: neuronatin
• Calculated Molecular Weight: 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC001768
• Gene Symbol: NNAT
• Gene ID (NCBI): 4826
• RRID: AB_2880678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16517
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Mol Sci; Characterizing SERCA Function in Murine Skeletal Muscles after 35-37 Days of Spaceflight.; Authors - Jessica L Braun
human	WB,IF	Front Cardiovasc Med; MiR-3064 in Epicardial Adipose-Derived Exosomes Targets Neuronatin to Regulate Adipogenic Differentiation of Epicardial Adipose Stem Cells.; Authors - Wenkai Yang
mouse	WB	FEBS Lett; Neuronatin promotes SERCA uncoupling and its expression is altered in skeletal muscles of high-fat diet-fed mice.; Authors - Jessica L Braun
human,mouse	IHC	J Toxicol Sci; Lidocaine prevents breast cancer growth by targeting neuronatin to inhibit nerve fibers formation.; Authors - Bingda Li
mouse	WB	FASEB Bioadv; Neuronatin regulates whole-body metabolism: is thermogenesis involved?; Authors - Jessica L Braun
mouse	WB	J Biol Chem; Low dose lithium supplementation promotes adipose tissue browning and sarco(endo)plasmic reticulum Ca2+ ATPase uncoupling in muscle; Authors - Mia S Geromella