NOD1 Polyclonal antibody

• 

  WB analysis using 14770-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14770-1-AP (NOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

NOD1 Polyclonal Antibody for WB, ELISA

Cat No. 14770-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CARD4, CLR7.1, NLRC1, NOD1

---

Tested Applications

• Positive WB detected in: 4T1 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14770-1-AP targets NOD1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6567

  Product name: Recombinant human NOD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 195-532 aa of BC040339

  Sequence: GETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFSCFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPDSSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAYARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMTLTDVFLLVTEVHLNRMQPSSLVQRNTHSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQEEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLD

• Full Name: nucleotide-binding oligomerization domain containing 1
• Calculated Molecular Weight: 108 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC040339
• Gene Symbol: NOD1
• Gene ID (NCBI): 10392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y239
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOD1 protein contains a caspase recruitment domain (CARD). NOD1 is a member of NOD-like receptor protein family and is a close relative of NOD2. NOD1 is ubiquitously expressed and recognizes bacterial peptidoglycan fragments, including d-glutamyl-meso-diaminopimelic acid found in gram-negative and some gram-positive bacteria. NOD1 plays a role in innate immunity by acting as a pattern-recognition receptor (PRR) that binds bacterial peptidoglycans and initiates inflammation. This protein has also been implicated in the immune response to viral and parasitic infection.