Product Information
27430-1-PBS targets NODAL in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26729 Product name: Recombinant human NODAL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 230-347 aa of BC104976 Sequence: EWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL Predict reactive species |
| Full Name | nodal homolog (mouse) |
| Calculated Molecular Weight | 347 aa, 40 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC104976 |
| Gene Symbol | NODAL |
| Gene ID (NCBI) | 4838 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S42 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Nodal is a member of the transforming growth factor-β (TGF-β) superfamily that plays critical roles during embryogenesis. Nodal also regulates cell proliferation, apoptosis, and invasion in cancer cells. However, it appears to exert both tumor-suppressing and tumor-promoting effects, depending on the cell type (PMID: 22645523). Nodal signals through ALK7 receptor to inhibit proliferation and to induce apoptosis in ovarian cancer cell lines and breast cancer cell lines (PMID: 15531507, PMID: 21383881).















