Product Information
84283-1-PBS targets NOG in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32755 Product name: Recombinant human NOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-145 aa of BC034027 Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL Predict reactive species |
| Full Name | noggin |
| Calculated Molecular Weight | 26 kDa |
| GenBank Accession Number | BC034027 |
| Gene Symbol | Noggin |
| Gene ID (NCBI) | 9241 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13253 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
