NOL3 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse skeletal muscle using 10846-2-AP (same clone as 10846-2-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 10846-2-AP (same clone as 10846-2-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10846-2-AP (same clone as 10846-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10846-2-AP (same clone as 10846-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10846-2-AP (NOL3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10846-2-AP (same clone as 10846-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10846-2-AP (NOL3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10846-2-AP (same clone as 10846-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NOL3 antibody (10846-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10846-2-AP (same clone as 10846-2-PBS)

  Immunofluorescent analysis of HepG2 cells, using NOL3 antibody 10846-2-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 10846-2-PBS in a different storage buffer formulation.

NOL3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10846-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Nop30, NOP, Myp, Muscle-enriched cytoplasmic protein, CARD2

---

Product Information

10846-2-PBS targets NOL3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1306

  Product name: Recombinant human NOL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC012798

  Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

• Full Name: nucleolar protein 3 (apoptosis repressor with CARD domain)
• Calculated Molecular Weight: 24 aa, 3 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC012798
• Gene Symbol: NOL3
• Gene ID (NCBI): 8996
• RRID: AB_2151850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60936
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.