NOL3 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 10846-2-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 10846-2-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10846-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10846-2-AP (NOL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 10846-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10846-2-AP (NOL3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10846-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10846-2-AP (NOL3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 10846-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NOL3 antibody (10846-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HepG2 using 10846-2-AP

  Immunofluorescent analysis of HepG2 cells, using NOL3 antibody 10846-2-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

NOL3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10846-2-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Nop30, NOP, Myp, Muscle-enriched cytoplasmic protein, CARD2

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

10846-2-AP targets NOL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1306

  Product name: Recombinant human NOL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC012798

  Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

• Full Name: nucleolar protein 3 (apoptosis repressor with CARD domain)
• Calculated Molecular Weight: 24 aa, 3 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC012798
• Gene Symbol: NOL3
• Gene ID (NCBI): 8996
• RRID: AB_2151850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Biochim Biophys Acta Mol Basis Dis; Gut-derived 4-hydroxyphenylacetic acid attenuates sepsis-induced acute kidney injury by upregulating ARC to inhibit necroptosis; Authors - Sheng An
rat	WB	Cell Death Dis; MicroRNA-30d regulates cardiomyocyte pyroptosis by directly targeting foxo3a in diabetic cardiomyopathy.; Authors - X Li
mouse	IF	Hum Genet; MS/MS in silico subtraction-based proteomic profiling as an approach to facilitate disease gene discovery: application to lens development and cataract.; Authors - Sandeep Aryal
mouse	WB	Pharmacol Biochem Behav; Involvement of microglial cells in the antinociceptive effects of metamizol in a mouse model of neuropathic pain.; Authors - R Zajaczkowska
human	IHC	Front Genet; Molecular Characterization and Clinical Relevance of RNA Binding Proteins in Colorectal Cancer.; Authors - Zhen Zhang
human	WB	Cell Cycle; Long noncoding RNA PCAT6 inhibits colon cancer cell apoptosis by regulating anti-apoptotic protein ARC expression via EZH2.; Authors - Weimei Huang