NOL6 Polyclonal antibody, PBS Only

• 

  WB analysis of A431 using 16361-1-AP (same clone as 16361-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 16361-1-AP (NOL6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16361-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 16361-1-AP (same clone as 16361-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 16361-1-AP (NOL6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16361-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 16361-1-AP (same clone as 16361-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed A431 cells using 16361-1-AP (NOL6 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16361-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NOL6 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16361-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16361-1-PBS targets NOL6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8368

  Product name: Recombinant human NOL6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 294-644 aa of BC008852

  Sequence: RVAYQREPQILKEVQSPEGMISLRDTAASLRLERDTRQLPLLTSALHGLQQQHPAFSGVARLAKRWVRAQLLGEGFADESLDLVAAALFLHPEPFTPPSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV

• Full Name: nucleolar protein family 6 (RNA-associated)
• Calculated Molecular Weight: 1146 aa, 127 kDa
• Observed Molecular Weight: 127 kDa
• GenBank Accession Number: BC008852
• Gene Symbol: NOL6
• Gene ID (NCBI): 65083
• RRID: AB_2151993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6R4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.