NOL6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NOL6 Polyclonal antibody (16361-1-AP)

• Featured Product
• KD/KO Validated

NOL6 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16361-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

NOL6, NRAP, Nucleolar protein 6, UTP22

• 

  WB analysis of A431 using 16361-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 16361-1-AP (NOL6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 16361-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 16361-1-AP (NOL6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 16361-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A431 cells using 16361-1-AP (NOL6 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NOL6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16361-1-AP targets NOL6 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8368

  Product name: Recombinant human NOL6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 294-644 aa of BC008852

  Sequence: RVAYQREPQILKEVQSPEGMISLRDTAASLRLERDTRQLPLLTSALHGLQQQHPAFSGVARLAKRWVRAQLLGEGFADESLDLVAAALFLHPEPFTPPSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV

• Full Name: nucleolar protein family 6 (RNA-associated)
• Calculated Molecular Weight: 1146 aa, 127 kDa
• Observed Molecular Weight: 127 kDa
• GenBank Accession Number: BC008852
• Gene Symbol: NOL6
• Gene ID (NCBI): 65083
• RRID: AB_2151993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6R4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NOL6 Polyclonal antibody (Cat# 16361-1-AP) has 3 citations published in Molecular Cell, Cell Reports, and Epigenomics. The research fields span nucleolar prion-like protein function in rRNA processing, lactylation-mediated NOL6 stabilization in colorectal cancer progression via YY1 deubiquitination, and NOL6 regulation of endometrial cancer cell proliferation and migration through TWIST1 expression.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; lncRNAs maintain the functional phase state of nucleolar prion-like protein to facilitate rRNA processing; Authors - Yu-Meng Sun
human	WB,IHC,IF,CoIP	Cell Rep; Lactylation-stabilized NOL6 promotes colorectal cancer progression via STAMBP-mediated YY1 deubiquitination and c-Myc transcription upregulation.; Authors - Hao Zhang ; KD Validated
human	WB,IF	Epigenomics; NOL6 promotes the proliferation and migration of endometrial cancer cells by regulating TWIST1 expression.; Authors - Junhui Liang ; KO Validated