Tested Applications
| Positive WB detected in | MDA-MB-453s cells, BxPC-3 cells, MCF-7 cells, mouse lung tissue, rat kidney tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
26854-1-AP targets NOP14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25476 Product name: Recombinant human NOP14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-95 aa of BC026035 Sequence: MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNM Predict reactive species |
| Full Name | NOP14 nucleolar protein homolog (yeast) |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 98 kDa |
| GenBank Accession Number | BC026035 |
| Gene Symbol | NOP14 |
| Gene ID (NCBI) | 8602 |
| RRID | AB_2880657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78316 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NOP14 antibody 26854-1-AP | Download protocol |
| WB protocol for NOP14 antibody 26854-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res HIV Vpr activates a nucleolar-specific ATR pathway to degrade the nucleolar stress sensor CCDC137 | ||
Cell Prolif CCND1, NOP14 and DNMT3B are involved in miR-502-5p-mediated inhibition of cell migration and proliferation in bladder cancer.
| ||
Aging (Albany NY) Exploring Cancer Dependency Map genes and immune subtypes in colon cancer, in which TIGD1 contributes to colon cancer progression | ||
Int J Biol Macromol CircNOP14 increases the radiosensitivity of hepatocellular carcinoma via inhibition of Ku70-dependent DNA damage repair | ||
Front Biosci (Landmark Ed) NOP14 as a Potential Predictor of Adult-Type Diffuse Glioma Prognosis and Immunotherapy, is Related to Cell Migration, Proliferation, and CD8+T Cell Infiltration |













