Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, U-87 MG cells, HSC-T6 cells, HepG2 cells, HeLa cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67681-1-Ig targets NOX4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6176 Product name: Recombinant human NOX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 224-578 aa of BC040105 Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS Predict reactive species |
| Full Name | NADPH oxidase 4 |
| Calculated Molecular Weight | 67 kDa |
| Observed Molecular Weight | 58-67 kDa |
| GenBank Accession Number | BC040105 |
| Gene Symbol | NOX4 |
| Gene ID (NCBI) | 50507 |
| RRID | AB_2882874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NPH5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage (PMID: 11728818, PMID: 29285262, PMID: 14670934). Nox4 in cardiac myocytes is primarily expressed in mitochondria, and upregulation of Nox4 induced by hypertrophic stimuli elicits mitochondrial dysfunction and cardiac failure. In breast or ovarian tumor cells, mitochondrial Nox4 contributes to oncogenesis. In vascular endothelial cells, however, Nox4 is expressed in the endoplasmic reticulum (ER) and plays a specific role in redox-mediated ER signaling (PMID: 24259511).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NOX4 antibody 67681-1-Ig | Download protocol |
| IHC protocol for NOX4 antibody 67681-1-Ig | Download protocol |
| WB protocol for NOX4 antibody 67681-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
67681-1-Ig is a NOX4 antibody with 28 total citations across 24 journals, including Bioactive Materials, Phytomedicine, Materials Today Bio, International Journal of Nanomedicine, Antioxidants, Journal of Pineal Research, British Journal of Pharmacology, Frontiers in Immunology, Journal of the American Heart Association, and European Journal of Pharmacology. Research fields encompass oxidative stress, hypertension, ferroptosis, mitochondrial dysfunction, cancer, sepsis, osteoarthritis, NAFLD, preeclampsia, neuroprotection, and aging.
| Species | Application | Title |
|---|---|---|
Bioact Mater Engineering biomimetic tarsal microtissue via structurally zoned hydrogel scaffold for integrated eyelid reconstruction. | ||
Phytomedicine NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes. | ||
Phytomedicine Nelumbo nucifera extract alleviates UVB-induced hyperpigmentation via NOX4-mediated AMPK-YAP-ATG5 signaling pathway. | ||
Mater Today Bio Dual-responsive nanoscale ultrasound contrast agent as an oxidative stress amplifier for enhanced DNA damage in BRCA-proficient ovarian cancer | ||
Int J Nanomedicine Liver-Targeting Nanoparticles GA-MSe@AR Treat NAFLD Through Dual Lipid-Lowering and Antioxidant Efficacy | ||
Antioxidants (Basel) The Effect of Tauroursodeoxycholic Acid (TUDCA) Treatment on Pregnancy Outcomes and Vascular Function in a Rat Model of Advanced Maternal Age |
