NOX4 Monoclonal antibody

NOX4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67681-1-Ig
Clone No.4E5F1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

4E5F1, EC:1.6.3.1, Kidney oxidase 1, Kidney oxidase-1, Kidney superoxide-producing NADPH oxidase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, U-87 MG cells, HSC-T6 cells, HepG2 cells, HeLa cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67681-1-Ig targets NOX4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6176

Product name: Recombinant human NOX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 224-578 aa of BC040105

Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

Predict reactive species
Full Name NADPH oxidase 4
Calculated Molecular Weight 67 kDa
Observed Molecular Weight58-67 kDa
GenBank Accession NumberBC040105
Gene Symbol NOX4
Gene ID (NCBI) 50507
RRIDAB_2882874
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NPH5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage (PMID: 11728818, PMID: 29285262, PMID: 14670934). Nox4 in cardiac myocytes is primarily expressed in mitochondria, and upregulation of Nox4 induced by hypertrophic stimuli elicits mitochondrial dysfunction and cardiac failure. In breast or ovarian tumor cells, mitochondrial Nox4 contributes to oncogenesis. In vascular endothelial cells, however, Nox4 is expressed in the endoplasmic reticulum (ER) and plays a specific role in redox-mediated ER signaling (PMID: 24259511).

Protocols

Product Specific Protocols
WB protocol for NOX4 antibody 67681-1-IgDownload protocol
IHC protocol for NOX4 antibody 67681-1-IgDownload protocol
IF protocol for NOX4 antibody 67681-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

J Am Heart Assoc

Janus Kinase 2/Signal Transducer and Activator of Transcription 3/Cyclooxygenase 2 Signaling Pathway Mediates the Effect of Central Angiotensin II on the Elevation of Rostral Ventrolateral Medulla Prostaglandin E2-Induced Oxidative Stress in Hypertension

Authors - Jie-Fu Fan
humanWB

Biomedicines

Identification of NOX4 as a New Biomarker in Hepatocellular Carcinoma and Its Effect on Sorafenib Therapy

Authors - Hui-Zhou Li
humanWB

Exp Biol Med (Maywood)

Triptolide decreases podocytes permeability by regulating TET2-mediated hydroxymethylation of ZO-1

Authors - Yue-Wen Tang
mouseWB,IP,IF

J Pineal Res

Melatonin Alleviates Osteoarthritis by Regulating NADPH Oxidase 4-Induced Ferroptosis and Mitigating Mitochondrial Dysfunction

Authors - Qi Wang
  • KD Validated
mouseWB

Mech Ageing Dev

Deletion of Stimulator of Interferons Genes Aggravated Cardiac Dysfunction in Physiological Aged Mice

Authors - Diansa Gao
ratWB,IF

Pflugers Arch

Placental ischemia-upregulated angiotensin II type 1 receptor in hypothalamic paraventricular nucleus contributes to hypertension in rat

Authors - Abdoulaye Issotina Zibrila
Loading...
||
New chat Able
正在加载,请稍候...