Tested Applications
Positive WB detected in | HEK-293 cells, Jurkat cells, U-87 MG cells, HSC-T6 cells, HepG2 cells, HeLa cells |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 13 publications below |
IF | See 6 publications below |
IP | See 1 publications below |
Product Information
67681-1-Ig targets NOX4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6176 Product name: Recombinant human NOX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 224-578 aa of BC040105 Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS Predict reactive species |
Full Name | NADPH oxidase 4 |
Calculated Molecular Weight | 67 kDa |
Observed Molecular Weight | 58-67 kDa |
GenBank Accession Number | BC040105 |
Gene Symbol | NOX4 |
Gene ID (NCBI) | 50507 |
RRID | AB_2882874 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NPH5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage (PMID: 11728818, PMID: 29285262, PMID: 14670934). Nox4 in cardiac myocytes is primarily expressed in mitochondria, and upregulation of Nox4 induced by hypertrophic stimuli elicits mitochondrial dysfunction and cardiac failure. In breast or ovarian tumor cells, mitochondrial Nox4 contributes to oncogenesis. In vascular endothelial cells, however, Nox4 is expressed in the endoplasmic reticulum (ER) and plays a specific role in redox-mediated ER signaling (PMID: 24259511).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NOX4 antibody 67681-1-Ig | Download protocol |
IHC protocol for NOX4 antibody 67681-1-Ig | Download protocol |
IF protocol for NOX4 antibody 67681-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Am Heart Assoc Janus Kinase 2/Signal Transducer and Activator of Transcription 3/Cyclooxygenase 2 Signaling Pathway Mediates the Effect of Central Angiotensin II on the Elevation of Rostral Ventrolateral Medulla Prostaglandin E2-Induced Oxidative Stress in Hypertension | ||
Biomedicines Identification of NOX4 as a New Biomarker in Hepatocellular Carcinoma and Its Effect on Sorafenib Therapy | ||
Exp Biol Med (Maywood) Triptolide decreases podocytes permeability by regulating TET2-mediated hydroxymethylation of ZO-1 | ||
J Pineal Res Melatonin Alleviates Osteoarthritis by Regulating NADPH Oxidase 4-Induced Ferroptosis and Mitigating Mitochondrial Dysfunction
| ||
Mech Ageing Dev Deletion of Stimulator of Interferons Genes Aggravated Cardiac Dysfunction in Physiological Aged Mice | ||
Pflugers Arch Placental ischemia-upregulated angiotensin II type 1 receptor in hypothalamic paraventricular nucleus contributes to hypertension in rat |