Tested Applications
Positive IHC detected in | human brain tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25517-1-AP targets NPB in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21877 Product name: Recombinant human NPB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 53-125 aa of BC126128 Sequence: ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA Predict reactive species |
Full Name | neuropeptide B |
Calculated Molecular Weight | 125 aa, 13 kDa |
Observed Molecular Weight | ~10 kDa |
GenBank Accession Number | BC126128 |
Gene Symbol | NPB |
Gene ID (NCBI) | 256933 |
RRID | AB_2880114 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NG41 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuropeptide B, also named as NPB, PPL7 and PPNBP, can be cleaved into two chains, Neuropeptide B-23 (NPB23, hL7) and Neuropeptide B-29 (NPB29, hL7C). It is involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. It is widely expressed in central nervous system.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for NPB antibody 25517-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |