NPB Polyclonal antibody, PBS Only

• 

  IHC staining of human brain using 25517-1-AP (same clone as 25517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25517-1-AP (NPB Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 25517-1-AP (same clone as 25517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25517-1-AP (NPB Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 25517-1-AP (same clone as 25517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25517-1-AP (NPB Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 25517-1-AP (same clone as 25517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25517-1-AP (NPB Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25517-1-PBS in a different storage buffer formulation.

NPB Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

25517-1-PBS targets NPB in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21877

  Product name: Recombinant human NPB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 53-125 aa of BC126128

  Sequence: ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA

• Full Name: neuropeptide B
• Calculated Molecular Weight: 125 aa, 13 kDa
• Observed Molecular Weight: ~10 kDa
• GenBank Accession Number: BC126128
• Gene Symbol: NPB
• Gene ID (NCBI): 256933
• RRID: AB_2880114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NG41
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuropeptide B, also named as NPB, PPL7 and PPNBP, can be cleaved into two chains, Neuropeptide B-23 (NPB23, hL7) and Neuropeptide B-29 (NPB29, hL7C). It is involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. It is widely expressed in central nervous system.