Tested Applications
Positive IHC detected in | human cerebellum tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24625-1-AP targets NPBWR1 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16604 Product name: Recombinant human NPBWR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC107101 Sequence: MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTN Predict reactive species |
Full Name | neuropeptides B/W receptor 1 |
Calculated Molecular Weight | 328 aa, 36 kDa |
GenBank Accession Number | BC107101 |
Gene Symbol | NPBWR1 |
Gene ID (NCBI) | 2831 |
RRID | AB_2879645 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48145 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for NPBWR1 antibody 24625-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |