NPHP5/IQCB1 Monoclonal antibody

• 

  WB analysis using 68404-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68404-1-Ig (NPHP5,IQCB1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

NPHP5/IQCB1 Monoclonal Antibody for WB, ELISA

Cat No. 68404-1-Ig

Clone No.2A9F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

IQ motif containing B1, IQCB1, KIAA0036, Nephrocystin 5, PIQ, SLSN5

---

Tested Applications

• Positive WB detected in: HaCaT cells, A431 cells, HT-1376 cells, Saos-2 cells, MDA-MB-468 cells, HEK-293 cells, COLO 320 cells, HL-60 cells, Daudi cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68404-1-Ig targets NPHP5/IQCB1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8203

  Product name: Recombinant human NPHP5,IQCB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC005806

  Sequence: MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKYRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELH

• Full Name: IQ motif containing B1
• Calculated Molecular Weight: 598 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC005806
• Gene Symbol: IQCB1
• Gene ID (NCBI): 9657
• RRID: AB_3085121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15051
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IQCB1, also known as NPHP5, is a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. It has a central coiled-coil region and two calmodulin-binding IQ domains. Localized to the primary cilia of renal epithelial cells and connecting cilia of photoreceptor cells, IQCB1 is thought to play a role in ciliary function. Mutations in this gene result in Senior-Loken syndrome type 5, a juvenile disorder characterized by defects in the waste filtering system of the kidney, as well as retinal degradation.