Tested Applications
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-27426 targets NPPA in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26692 Product name: Recombinant human NPPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-153 aa of BC005893 Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR Predict reactive species |
| Full Name | natriuretic peptide precursor A |
| Calculated Molecular Weight | 153 aa, 17 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC005893 |
| Gene Symbol | NPPA |
| Gene ID (NCBI) | 4878 |
| RRID | AB_3672812 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01160 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 NPPA antibody CL488-27426 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

