Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | mouse heart tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27426-1-AP targets NPPA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26692 Product name: Recombinant human NPPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-153 aa of BC005893 Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR Predict reactive species |
| Full Name | natriuretic peptide precursor A |
| Calculated Molecular Weight | 153 aa, 17 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC005893 |
| Gene Symbol | NPPA |
| Gene ID (NCBI) | 4878 |
| RRID | AB_2880868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01160 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NPPA antibody 27426-1-AP | Download protocol |
| IHC protocol for NPPA antibody 27426-1-AP | Download protocol |
| WB protocol for NPPA antibody 27426-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NPPA Polyclonal antibody (catalog no. 27426-1-AP) has 124 citations. It appears in high-impact journals including Nature Communications, Autophagy, EMBO Molecular Medicine, Cell Death & Differentiation, Cell Death & Disease, Acta Pharmacologica Sinica, European Journal of Pharmacology, Biochemical Pharmacology, Journal of Cellular and Molecular Medicine, and iScience. The research fields are overwhelmingly cardiovascular, focusing on pathological cardiac hypertrophy, heart failure, diabetic cardiomyopathy, cardiotoxicity, and myocardial remodeling, with applications mainly in Western blot and immunofluorescence.
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles Salvianolic Acid B Upregulates miR-744-5p Expression in Peripheral Blood Mononuclear Cell-Derived Extracellular Vesicles to Alleviate Uremic Cardiomyopathy. | ||
Autophagy Cardiac fibroblast-derived CCN1 aggravates diabetic cardiomyopathy through ITGAV-ITGB1/integrin αvβ1-mediated autophagy inhibition. | ||
Nat Commun Single-nuclei multiomics analysis identifies abnormal cardiomyocytes in a murine model of cardiac development | ||
Nat Commun SNAP25-dependent membrane trafficking of the Kv1.5 channel regulates the onset of atrial fibrillation | ||
Nat Commun Bclaf1 drives heart failure by recruiting Srsf2 to enhance Hand2 pre-mRNA splicing and pathological hypertrophy. | ||
Nat Commun Modeling early human heart development using an iPSC-based 3D bioprinted model of embryonic heart tube. |
Reviews
What customers say
Users report consistent performance across Western blot, immunofluorescence, and immunohistochemistry. WB and IF yielded clear results even at the lowest recommended dilution in iPS-derived cardiomyocytes and fibroblasts. One WB user noted a weak smear band in mouse heart tissue, suggesting high-resolution gels may help. IHC at 1:100 and 1:200 showed positive nuclear staining in neonatal mouse ventricular cardiomyocyte cultures, with one user confirming hypertrophy-induced expression. Overall, the antibody is well-received for cardiac research applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Asim (Verified Customer) (12-12-2025) | Western blot bands and IF worked nicely even with the lowest recommended concentration.
|
WEI (Verified Customer) (05-11-2022) | Weak but smear band might need high resolution gels
|
Yan (Verified Customer) (08-19-2020) | It worked when I performed the immunostaining in neonatal mouse ventricular cardiomyocytes culture. Hypertrophy stimulus induced its expression.
|
Jie (Verified Customer) (03-06-2020) | IHC shoes a positive staining in the nuclei
 |
