Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | mouse heart tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 57 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
27426-1-AP targets NPPA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26692 Product name: Recombinant human NPPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-153 aa of BC005893 Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR Predict reactive species |
| Full Name | natriuretic peptide precursor A |
| Calculated Molecular Weight | 153 aa, 17 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC005893 |
| Gene Symbol | NPPA |
| Gene ID (NCBI) | 4878 |
| RRID | AB_2880868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01160 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NPPA antibody 27426-1-AP | Download protocol |
| IHC protocol for NPPA antibody 27426-1-AP | Download protocol |
| WB protocol for NPPA antibody 27426-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Med PINK1 modulates Prdx2 to reduce lipotoxicity-induced apoptosis and attenuate cardiac dysfunction in heart failure mice with a preserved ejection fraction | ||
Acta Pharmacol Sin YOD1 mediates isoproterenol-induced cardiac remodeling by deubiquitinating PKM2 and reducing PKM2 tetramerization in cardiomyocytes | ||
Mol Ther Nucleic Acids Overexpression of cytosolic long noncoding RNA cytb protects against pressure-overload-induced heart failure via sponging microRNA-103-3p. | ||
Biochim Biophys Acta Mol Basis Dis Soluble epoxide hydrolase and TRPC3 channels jointly contribute to homocysteine-induced cardiac hypertrophy: Interrelation and regulation by C/EBPβ | ||
Pharmacol Res Cullin-associated and neddylation-dissociated 1 protein (CAND1) governs cardiac hypertrophy and heart failure partially through regulating calcineurin degradation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Asim (Verified Customer) (12-12-2025) | Western blot bands and IF worked nicely even with the lowest recommended concentration.
|
FH WEI (Verified Customer) (05-11-2022) | Weak but smear band might need high resolution gels
|
FH Yan (Verified Customer) (08-19-2020) | It worked when I performed the immunostaining in neonatal mouse ventricular cardiomyocytes culture. Hypertrophy stimulus induced its expression.
|
FH Jie (Verified Customer) (03-06-2020) | IHC shoes a positive staining in the nuclei
![]() |


















