NPPA Polyclonal antibody

NPPA Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 27426-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

ANP, PND, ANF, ATFB6, Atrial natriuretic factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, rat heart tissue
Positive IHC detected inmouse heart tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27426-1-AP targets NPPA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26692

Product name: Recombinant human NPPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-153 aa of BC005893

Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR

Predict reactive species
Full Name natriuretic peptide precursor A
Calculated Molecular Weight 153 aa, 17 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC005893
Gene Symbol NPPA
Gene ID (NCBI) 4878
RRIDAB_2880868
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01160
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus.

Protocols

Product Specific Protocols
IF protocol for NPPA antibody 27426-1-APDownload protocol
IHC protocol for NPPA antibody 27426-1-APDownload protocol
WB protocol for NPPA antibody 27426-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Clin Transl Med

PINK1 modulates Prdx2 to reduce lipotoxicity-induced apoptosis and attenuate cardiac dysfunction in heart failure mice with a preserved ejection fraction

Authors - Hao Zhang
rat,mouseWB

Cell Death Dis

Asb10 accelerates pathological cardiac remodeling by stabilizing HSP70

Authors - Ke Lin

Acta Pharmacol Sin

YOD1 mediates isoproterenol-induced cardiac remodeling by deubiquitinating PKM2 and reducing PKM2 tetramerization in cardiomyocytes

Authors - Qing-Song Zheng
mouseWB

Mol Ther Nucleic Acids

Overexpression of cytosolic long noncoding RNA cytb protects against pressure-overload-induced heart failure via sponging microRNA-103-3p.

Authors - Xudong Zhang
ratWB

Biochim Biophys Acta Mol Basis Dis

Soluble epoxide hydrolase and TRPC3 channels jointly contribute to homocysteine-induced cardiac hypertrophy: Interrelation and regulation by C/EBPβ

Authors - Yang Zhou
mouse,humanWB

Pharmacol Res

Cullin-associated and neddylation-dissociated 1 protein (CAND1) governs cardiac hypertrophy and heart failure partially through regulating calcineurin degradation.

Authors - Xingda Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

WEI (Verified Customer) (05-11-2022)

Weak but smear band might need high resolution gels

  • Applications: Western Blot
  • Cell Tissue Type: Mouse Heart
FH

Yan (Verified Customer) (08-19-2020)

It worked when I performed the immunostaining in neonatal mouse ventricular cardiomyocytes culture. Hypertrophy stimulus induced its expression.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: neonatal mouse ventricular cardiomyocytes culture
FH

Jie (Verified Customer) (03-06-2020)

IHC shoes a positive staining in the nuclei

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: cardiomyocyte culture
NPPA Antibody Immunohistochemistry, validation (1:200 dilution) in cardiomyocyte culture (Cat no:27426-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...