Tested Applications
| Positive IHC detected in | mouse heart tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28214-1-AP targets NPPB in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28133 Product name: Recombinant human BNP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-134 aa of BC025785 Sequence: HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Predict reactive species |
| Full Name | natriuretic peptide precursor B |
| Calculated Molecular Weight | 134 aa, 15 kDa |
| GenBank Accession Number | BC025785 |
| Gene Symbol | BNP |
| Gene ID (NCBI) | 4879 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16860 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NPPB, also known as B-type natriuretic peptide (BNP), is a cardiac hormone that is secreted mainly in the ventricles in response to increased wall stress. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. BNP is a marker of systolic and diastolic dysfunction and a strong predictor of mortality in heart failure patients.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NPPB antibody 28214-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



