BNP/NPPB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BNP/NPPB Polyclonal antibody (28214-1-AP)

• 

  IHC staining of rat brain using 28214-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28214-1-AP (BNP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 28214-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28214-1-AP (BNP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BNP/NPPB Polyclonal Antibody for IHC, ELISA

Cat No. 28214-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

Natriuretic peptides B, NPPB, BNP, BNP(1 32), BNP(1-28)

---

Tested Applications

• Positive IHC detected in: mouse heart tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28214-1-AP targets BNP/NPPB in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28133

  Product name: Recombinant human BNP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-134 aa of BC025785

  Sequence: HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

• Full Name: natriuretic peptide precursor B
• Calculated Molecular Weight: 134 aa, 15 kDa
• GenBank Accession Number: BC025785
• Gene Symbol: BNP
• Gene ID (NCBI): 4879
• RRID: AB_3742285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16860
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPPB, also known as B-type natriuretic peptide (BNP), is a cardiac hormone that is secreted mainly in the ventricles in response to increased wall stress. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. BNP is a marker of systolic and diastolic dysfunction and a strong predictor of mortality in heart failure patients.