NPS Polyclonal antibody

• 

  IHC staining of human brain using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23609-1-AP (NPS antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23609-1-AP (NPS antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 23609-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 40x lens).

NPS Polyclonal Antibody for IHC, ELISA

Cat No. 23609-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

neuropeptide S, NPS

---

Tested Applications

• Positive IHC detected in: human pancreas cancer tissue, human brain tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23609-1-AP targets NPS in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20322

  Product name: Recombinant human NPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-89 aa of BC156665

  Sequence: YPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS

• Full Name: neuropeptide S
• Calculated Molecular Weight: 89 aa, 10 kDa
• GenBank Accession Number: BC156665
• Gene Symbol: NPS
• Gene ID (NCBI): 594857
• RRID: AB_2879303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P0C0P6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.