NPTXR Polyclonal antibody

• 

  WB analysis using 24807-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24807-1-AP (NPTXR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 24807-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24807-1-AP (NPTXR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24807-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24807-1-AP (NPTXR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 24807-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using NPTXR antibody (24807-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NPTXR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24807-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Neuronal pentraxin receptor

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24807-1-AP targets NPTXR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20185

  Product name: Recombinant human NPTXR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-296 aa of BC153027

  Sequence: DSPALILELEDAVRALRDRIDRLEQELPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPIRNNYMYA

• Full Name: neuronal pentraxin receptor
• Calculated Molecular Weight: 489 aa, 52 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC153027
• Gene Symbol: NPTXR
• Gene ID (NCBI): 23467
• RRID: AB_3085756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95502
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPTXR (Neuronal Pentraxin Receptor) is a type II transmembrane glycoprotein primarily expressed in the cerebellum and hippocampus. It mediates synaptic plasticity by clustering AMPA-type glutamate receptors at excitatory synapses and promoting synaptogenesis. NPTXR can be proteolytically cleaved to release a soluble form. Its dysregulation is implicated in Alzheimer's disease and small-cell lung cancer.(PMID: 9261167; 18367087; 19368810; 16115696)