NPY1R Polyclonal antibody

• 

NPY1R Polyclonal Antibody for IHC, ELISA

Cat No. 12784-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

Neuropeptide Y receptor type 1, neuropeptide Y receptor Y1, NPY1R

---

Product Information

12784-1-AP targets NPY1R in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3496

  Product name: Recombinant human NPY1R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-384 aa of BC036657

  Sequence: MISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

• Full Name: neuropeptide Y receptor Y1
• Calculated Molecular Weight: 384 aa, 44 kDa
• GenBank Accession Number: BC036657
• Gene Symbol: NPY1R
• Gene ID (NCBI): 4886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.