NR5A1 Polyclonal antibody

NR5A1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 18658-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF, FC (Intra), IP, ChIP, ELISA

AD4BP, Adrenal 4 binding protein, Adrenal 4-binding protein, ELP, FTZ1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse ovary tissue, rat ovary tissue
Positive IP detected inA2780 cells
Positive IHC detected inhuman ovary tissue, human liver tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18658-1-AP targets NR5A1 in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, goat, camel, ondatra zibethicus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13252

Product name: Recombinant human NR5A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-349 aa of BC032501

Sequence: MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVL

Predict reactive species
Full Name nuclear receptor subfamily 5, group A, member 1
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC032501
Gene Symbol NR5A1
Gene ID (NCBI) 2516
RRIDAB_10596916
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13285
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Steroidogenic factor-1 (SF-1,STF-1), also known as NR5A1, regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. Initially identified as a tissue-specific transcriptional regulator of cytochrome P450 steroid hydroxylases, research studies of both global and tissue-specific knockout mice have demonstrated that SF-1 is required for the development of adrenal glands, gonads, ventromedial hypothalamus, and for the proper functioning of pituitary gonadotropes. Indeed, humans with mutations that render SF-1 transcriptionally inactive can present with testicular failure, ovarian failure, and adrenal insufficiency. Furthermore, dysregulation of SF-1 has been linked to diseases such as endometriosis and adrenocortical carcinoma.Like other nuclear hormone receptors, SF-1 has a modular domain structure composed of an N-terminal zinc finger DNA-binding domain, a ligand-binding domain, a C-terminal AF-2 activation domain, and a hinge region with AF-1-like activation activity. SF-1 also contains a fushi tarazu factor 1 box, which functions as an accessory DNA binding domain. SF-1 is primarily phosphorylated at Ser203, which is thought to enhance its transcriptional activity by promoting complex formation with transcriptional cofactors. In addition to phosphorylation at Ser203, SF-1 is subject to SUMO conjugation and acetylation at ε-amino groups of target lysine residues. Whereas SUMOylation represses SF-1 function, acetylation enhances its transcriptional activity.In the adult ovary, SF-1 localizes to theca/interstitial cells.

Protocols

Product Specific Protocols
FC protocol for NR5A1 antibody 18658-1-APDownload protocol
IHC protocol for NR5A1 antibody 18658-1-APDownload protocol
IP protocol for NR5A1 antibody 18658-1-APDownload protocol
WB protocol for NR5A1 antibody 18658-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

J Hazard Mater

GRP78/IRE1 and cGAS/STING pathway crosstalk through CHOP facilitates iodoacetic acid-mediated testosterone decline

Authors - Li Mou
humanIF

Elife

Induction of Sertoli-like cells from human fibroblasts by NR5A1 and GATA4.

Authors - Jianlin Liang
mouseWB,IF

Elife

PRMT5 regulates ovarian follicle development by facilitating Wt1 translation

Authors - Min Chen
mouseIHC

Mol Cell Endocrinol

Pde8b haploinsufficiency in mice is associated with modest adrenal defects, impaired steroidogenesis, and male infertility, unaltered by concurrent PKA or Wnt activation.

Authors - Leticia Ferro Leal
Ondatra zibethicusIHC

J Steroid Biochem Mol Biol

Seasonal expressions of SF-1, StAR and P450scc in the scent glands of the muskrats (Ondatra zibethicus).

Authors - Wenqian Xie
mouseIF

Toxicol Appl Pharmacol

PMID: 31175881

Authors - Jiandong Sun
Loading...
||
New chat

Able

正在加载,请稍候...