NRAC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human heart using 87528-1-RR (same clone as 87528-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 87528-1-RR (NRAC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87528-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87528-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87528-1-RR against Human NRAC were performed. The affinity constant is 0.801 nM.

NRAC Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87528-1-PBS

Clone No.252953C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C14orf180, C14orf77, Nutritionally-regulated adipose and cardiac enriched protein homolog

---

Product Information

87528-1-PBS targets NRAC in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6025

  Product name: Recombinant human NRAC protein (C-rFc)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-100 aa of NM_001008404.2

  Sequence: MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNATATVRVPGRPRPH

• Full Name: chromosome 14 open reading frame 180
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: NM_001008404.2
• Gene Symbol: C14orf180
• Gene ID (NCBI): 400258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N912
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NRAC (Nutritionally Regulated Adipose and Cardiac enriched protein, with the human homologous gene designated as C14ORF180) is a recently identified adipocyte-specific double-pass transmembrane protein. Both its N- and C-termini are located intracellularly, containing only a short extracellular loop and no known enzymatic domains. Its expression is significantly induced during the differentiation of white and brown adipocytes and is regulated by nutritional status: fasting and obesity both downregulate its mRNA levels, suggesting its role as a "fat sensor" in energy homeostasis. Mechanistically, NRAC forms a trimeric complex via its first transmembrane domain with the fatty acid transporter core protein CD36 and the membrane microdomain protein caveolin-1. When extracellular fatty acid concentrations increase, NRAC undergoes ubiquitination and internalization, causing CD36 to dissociate from caveolin-1 and switch to clathrin-mediated endocytosis. This process enhances fatty acid uptake, leading to adipocyte hypertrophy and increased overall adipose mass.