• Featured Product
  • KD/KO Validated

NRAS Polyclonal antibody

NRAS Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10724-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

HRAS1, EC:3.6.5.2, GTPase NRas, N ras, NRAS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, C6 cells, NIH/3T3 cells, Jurkat cells, A549 cells, HEK-293 cells, MCF-7 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman pancreas tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10724-1-AP targets NRAS in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1081

Product name: Recombinant human NRAS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-189 aa of BC005219

Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Predict reactive species
Full Name neuroblastoma RAS viral (v-ras) oncogene homolog
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC005219
Gene Symbol NRAS
Gene ID (NCBI) 4893
RRIDAB_2154209
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01111
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuroblastoma rat sarcoma viral oncogene homolog (NRAS) was originally identified as the third RAS family member following KRAS and HRAS in human neuroblastoma and fibrosarcoma cell lines (PMID: 6572964). Akin to KRAS, NRAS encodes small GTP enzymes which regulate cell cycle, proliferation, maturation and differentiation by transducing signals from membrane-localized receptor tyrosine kinases to the nucleus. The mutation of RAS gene family occurs in nearly 30% of human cancers (PMID: 12509763). NRAS plays an important role in EGFR mediating RAS/RAF/MEK/ERK and PI3K/AKT/mTOR signaling pathways (PMID: 17297468). The mutation of NRAS leads to continuous activation of Ras-GTP, which promotes tumorigenesis and metastasis. It has been proved that NRAS acts as a negative prognosis predictor in numerous somatic malignancies, such as melanoma, colorectal cancer and hepatocellular carcinoma (PMID: 30685691, PMID: 30484984). Besides, NRAS, as a proto-oncogene, is also proved to be associated with tumor immune microenvironment (TIM) both in vivo and in vitro. NRAS GTPase is related to T-cell proliferation and immune response (PMID: 34746975). NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML).

Protocols

Product Specific Protocols
FC protocol for NRAS antibody 10724-1-APDownload protocol
IF protocol for NRAS antibody 10724-1-APDownload protocol
IHC protocol for NRAS antibody 10724-1-APDownload protocol
IP protocol for NRAS antibody 10724-1-APDownload protocol
WB protocol for NRAS antibody 10724-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Cell Biol

ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16INK4a levels.

Authors - Xue Hao
humanWB

Gut

RNA helicase DDX5 enables STAT1 mRNA translation and interferon signalling in hepatitis B virus replicating hepatocytes.

Authors - Jiazeng Sun
humanWB

Nat Commun

Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma

Authors - Perla Pucci
humanIF

Nat Commun

KRAS regulation by small non-coding RNAs and SNARE proteins.

Authors - Yonglu Che
mouse,humanWB

Biomaterials

Polymeric nanoparticle mediated inhibition of miR-21 with enhanced miR-124 expression for combinatorial glioblastoma therapy.

Authors - Yuanyuan Liu
humanWB

Clin Cancer Res

Combinations with Allosteric SHP2 Inhibitor TNO155 to Block Receptor Tyrosine Kinase Signaling.

Authors - Chen Liu
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

RAFAEL (Verified Customer) (03-18-2026)

The antibody is not entirely specific, as it recognizes other Ras isoforms such as KRAS

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela cells
NRAS Antibody Western Blot validation (1:1000 dilution) in Hela cells (Cat no:10724-1-AP)
FH

Brandon (Verified Customer) (11-27-2018)

Worked excellent on mouse tissue from inducible tumor model!

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse Tumor Tissue
Loading...
||
New chat

Able

正在加载,请稍候...