• Featured Product
  • KD/KO Validated

NRCAM Polyclonal antibody

NRCAM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 21608-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Ng-CAM-related, Ng CAM related, Neuronal surface protein Bravo, neuronal cell adhesion molecule, KIAA0343

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, HEK-293 cells, rat brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21608-1-AP targets NRCAM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16237

Product name: Recombinant human NRCAM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 446-628 aa of BC098401

Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV

Predict reactive species
Full Name neuronal cell adhesion molecule
Calculated Molecular Weight 1304 aa, 144 kDa
Observed Molecular Weight 130-136 kDa
GenBank Accession NumberBC098401
Gene Symbol NRCAM
Gene ID (NCBI) 4897
RRIDAB_10859786
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92823
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708).

Protocols

Product Specific Protocols
IF protocol for NRCAM antibody 21608-1-APDownload protocol
IHC protocol for NRCAM antibody 21608-1-APDownload protocol
WB protocol for NRCAM antibody 21608-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Stem Cell Reports

CD73 Regulates Stemness and Epithelial-Mesenchymal Transition in Ovarian Cancer-Initiating Cells.

Authors - Michela Lupia
humanWB

Mol Cell Proteomics

Application of mass spectrometry profiling to establish brusatol as an inhibitor of global protein synthesis.

Authors - Steffan Vartanian
humanWB

Front Oncol

An Essential NRP1-Mediated Role for Tagln2 in Gastric Cancer Angiogenesis.

Authors - Hongwei Jin
human

mBio

Identification of the Staphylococcus aureus endothelial cell surface interactome by proximity labeling

Authors - Marcel Rühling
humanWB

Cancer Gene Ther

NrCAM secreted by endometrial stromal cells enhances the progestin sensitivity of endometrial cancer cells through epigenetic modulation of PRB.

Authors - Yali Cheng
  • KD Validated
mouseIHC

Mol Cell Neurosci

Matrix metalloprotease-mediated cleavage of neural glial-related cell adhesion molecules activates quiescent olfactory stem cells via EGFR.

Authors - Zhen-Huang Chen
Loading...
||
New chat Able
正在加载,请稍候...