NRD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 15630-1-AP (same clone as 15630-1-PBS)

  K-562 cells lysates were subjected to SDS PAGE followed by western blot with 15630-1-AP (NRD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15630-1-AP (same clone as 15630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15630-1-AP (NRD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15630-1-AP (same clone as 15630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15630-1-AP (NRD1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15630-1-PBS in a different storage buffer formulation.

NRD1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15630-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15630-1-PBS targets NRD1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7923

  Product name: Recombinant human NRD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 801-1150 aa of BC008775

  Sequence: YFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTTLNLLPYHKIVK

• Full Name: nardilysin (N-arginine dibasic convertase)
• Calculated Molecular Weight: 132 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: BC008775
• Gene Symbol: NRD1
• Gene ID (NCBI): 4898
• RRID: AB_2154525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43847
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NRD1(Nardilysin) is also named as NRD-C(N-arginine dibasic convertase). It is a zinc metalloendopeptidase of the M16 pitrilysin family that cleaves peptides at dibasic residues. The enzyme has also been found in neural tissues of mouse embryos indicating a role in neural development. Although nardilysin is primarily found in the cytosol, it has been reported that nardilysin is located on the cell surface acting as a receptor for heparinbinding EGF-like growth factor(PMID:15809022). It has 2 isoforms produced by alternative splicing.