Neurogranin Recombinant monoclonal antibody, PBS Only

Neurogranin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 83593-5-PBS
Clone No.240526B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

NRGN, 240526B9, hng, NEUG(55-78), Ng

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83593-5-PBS targets Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0676

Product name: Recombinant human NRGN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-78 aa of BC002835

Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Predict reactive species
Full Name neurogranin (protein kinase C substrate, RC3)
Calculated Molecular Weight 7.6 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC002835
Gene Symbol Neurogranin
Gene ID (NCBI) 4900
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ92686
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neurogranin (formerly designated p17, also known as Ng, RC3 and BICKS) belongs to the neurogranin family. It is a neuron-specific substrate for protein kinase C (PKC). It is a postsynaptic protein that is highly enriched in brain, with restricted expression in the cortex, striatum, hippocampus, thalamus, hypothalamus and olfactory bulb nuclei. Neurogranin binds calmodulin at low levels of calcium, thereby regulating calmodulin-dependent nitric oxide synthase. Neurogranin acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium.

Loading...
||
New chat Able
正在加载,请稍候...