Tested Applications
| Positive WB detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21284-1-AP targets NT5C1A in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15802 Product name: Recombinant human NT5C1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC103880 Sequence: MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFD Predict reactive species |
| Full Name | 5'-nucleotidase, cytosolic IA |
| Calculated Molecular Weight | 368 aa, 41 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC103880 |
| Gene Symbol | NT5C1A |
| Gene ID (NCBI) | 84618 |
| RRID | AB_3085649 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NT5C1A (5′-nucleotidase cytosolic 1A) is a 365 amino acid protein belonging to the 5′-nucleotidase type 3 family. AMP can be deaminated by AMP-deaminase (AMPD) to IMP, which is hydrolyzed to inosine by cytosolic 5'-nucleotidase II (NT5C2). AMP can also be hydrolyzed to adenosine by cytosolic 5'-nucleotidase 1A (NT5C1A). NT5C1A also assists in the regulation of adenosine levels in heart during ischemia and hypoxia.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NT5C1A antibody 21284-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

