Tested Applications
Positive IP detected in | mouse testis tissue, HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26242-1-AP targets NT5DC3 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23962 Product name: Recombinant human NT5DC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC052293 Sequence: MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEI Predict reactive species |
Full Name | 5'-nucleotidase domain containing 3 |
Observed Molecular Weight | 63 kDa |
GenBank Accession Number | BC052293 |
Gene Symbol | NT5DC3 |
Gene ID (NCBI) | 51559 |
RRID | AB_2880442 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86UY8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IP protocol for NT5DC3 antibody 26242-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |